PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA23G00017
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 240aa    MW: 27891.5 Da    PI: 6.6582
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA23G00017genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l+++++++G ++W++ ++  g+ R++k+c++rw +yl
       AA23G00017 14 KGSWTPEEDEILINYINLHGHPNWRALPKLAGLARCGKSCRLRWINYL 61
                     799*******************************************97 PP

2Myb_DNA-binding52.71e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E+e ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
       AA23G00017  67 RGNFTSQEEETIINLHQILGNR-WSAIAAKLP-GRTDNEIKNVWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129423.643965IPR017930Myb domain
SuperFamilySSF466893.74E-3010108IPR009057Homeodomain-like
SMARTSM007176.4E-141363IPR001005SANT/Myb domain
PfamPF002491.9E-161461IPR001005SANT/Myb domain
CDDcd001672.77E-101661No hitNo description
Gene3DG3DSA:1.10.10.602.0E-2665115IPR009057Homeodomain-like
PROSITE profilePS5129418.04866116IPR017930Myb domain
SMARTSM007174.6E-1466114IPR001005SANT/Myb domain
PfamPF002496.9E-1567112IPR001005SANT/Myb domain
CDDcd001678.30E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGRKPCCEKM GMKKGSWTPE EDEILINYIN LHGHPNWRAL PKLAGLARCG KSCRLRWINY  60
LRPDIKRGNF TSQEEETIIN LHQILGNRWS AIAAKLPGRT DNEIKNVWNT HLKKKFDQNN  120
NEIICDIQKR SCKNKKKKID VVKVEESPKS LEQHSNISEI TTSDNNNEVS CNNKDCVTSS  180
EDFPVLIDES FWSEIISIEY NISEFVKKER KIENWEESLD SNESNDMEVW FDLLTNSCRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121175109B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00127DAPTransfer from AT1G06180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006417949.11e-104hypothetical protein EUTSA_v10008531mg
SwissprotQ7XBH41e-72MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLV4L2001e-104V4L200_EUTSA; Uncharacterized protein
STRINGAT1G06180.11e-100(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06180.17e-98myb domain protein 13